PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10026801m
Common NameCARUB_v10026801mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 317aa    MW: 35494.2 Da    PI: 6.6283
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10026801mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv +++ +G+g W+t ++  g++R++k+c++rw +yl
  Carubv10026801m 14 KGPWTPEEDEKLVGYIQTHGPGKWRTLPKNAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.62.1e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg ++ +E+e +++++++lG++ W+ Ia +++ gRt++++k++w+++
  Carubv10026801m  67 RGEFSLQEEETIIQLHRLLGNK-WSVIAIHLP-GRTDNEIKNYWNTH 111
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-25764IPR009057Homeodomain-like
PROSITE profilePS5129418.092961IPR017930Myb domain
SuperFamilySSF466893.18E-3012108IPR009057Homeodomain-like
SMARTSM007177.7E-141363IPR001005SANT/Myb domain
PfamPF002499.6E-161461IPR001005SANT/Myb domain
CDDcd001674.73E-111661No hitNo description
PROSITE profilePS5129425.44962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2565116IPR009057Homeodomain-like
SMARTSM007178.2E-1666114IPR001005SANT/Myb domain
PfamPF002494.1E-1567111IPR001005SANT/Myb domain
CDDcd001671.44E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGKSSSSEES EVKKGPWTPE EDEKLVGYIQ THGPGKWRTL PKNAGLKRCG KSCRLRWTNY  60
LRPDIKRGEF SLQEEETIIQ LHRLLGNKWS VIAIHLPGRT DNEIKNYWNT HIKKKLLRMG  120
IDPVTHCPRI NLLQLSSLLT SSLFKSMSQP PMNTPFDLTT SNINPDVLNH LNNVQTESYQ  180
PNQHLQNDLN STEQITFTGL LNSTPPVQWQ NNGEFMGDYL DYTGSGDPSN NQVPQTGNYS  240
SASFLSDHIN DSESFKAGWN FSSSMLPGTS SSSSTPLNSS STFHVNGGSE DDRESYGSDM  300
LMFHHHHDHN NASNLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-29111161105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00563DAPTransfer from AT5G54230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759910.0AF175991.1 Arabidopsis thaliana putative transcription factor (MYB49) mRNA, complete cds.
GenBankAY0598200.0AY059820.1 Arabidopsis thaliana Myb-related transcription factor-like protein (At5g54230; MDK4.5) mRNA, complete cds.
GenBankAY0815120.0AY081512.1 Arabidopsis thaliana Myb-related transcription factor-like protein (At5g54230) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006279653.10.0hypothetical protein CARUB_v10026801mg
TrEMBLR0EUU40.0R0EUU4_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_80014660.0(Arabidopsis lyrata)
STRINGfgenesh1_pm.C_scaffold_80011140.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144651722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G54230.11e-173myb domain protein 49